Middle east ping test This online tool estimates the network latency from your browser to AWS EC2, Azure Storage Account, Alibaba OSS and Huawei Cloud OBS in Africa and Middle East. Test ping time for different AWS (Amazon Web Services) regions from your web browser Middle East: ping-me. Analysis takes ~10 seconds and will outbook your max, min and average ping over those 10 seconds, along with your ping live stream. epicgames. Globalping - Internet and web infrastructure monitoring and benchmarking by jsDelivr Toggle navigation Run a free ping network test from multiple locations including Dubai to any IP, hostname, domain or website you wish. The massively popular massively multiplayer online game. Anything under 100ms is acceptable for most online activities, while anything over 150ms may result in noticeable lag. Once you load the page, the tool Oct 3, 2023 · Asia: ping-asia. Lower ping means faster response, crucial for gaming and real-time activities. In order to give the new community time to stabilize, we're only accepting players into the ME server at first. Middle East: ping-me. My ping in EUW is 80ms i'm form North Africa , any idea what's the ping is gonna be in the new middle east server? About Press Copyright Contact us Creators Advertise Developers Terms Privacy Policy & Safety How YouTube works Test new features NFL Sunday Ticket Press Copyright So Ubisoft rolled UAE servers for the middle east players which is great. Oct 30, 2024 · Download the app from the repository GitHub: brawlhalla-ping-checker [github. 3 -t; EUNE (Europe Nordic & East) server: ping 104. Test My Download Speed Test My Upload Speed. on Our League of Legends Ping Test Tool quickly measures your connection speed to provide accurate ping results for the game. Ping is tested via websockets technology. net's Download Speed Test and Upload Speed Test log connection information to allow users to research real world Internet speed test results. Transfers out of ME are scheduled to become available around September 3, 2024 at 11am PT / 9pm EEST, but note that this date/time may change depending on the state of the servers. Open the app and select your region’s server by clicking the corresponding button. am in the Middle East when I launched the game tell that I'm on a Middle East server it took 10-5 min to find a game then it join me on a European server with 100 pings but in the testing range it join me to a middle east server, So the middle east server work but for some reason, it forces me to European server LoL Ping Checker. brawlhalla. So we have put together this LOL ping test to make sure people can track the latency of their network connection. Measure the response (ping) to servers located around the world. 160. Do you want to research connection speed for The United Arab Emirates (AE)? TestMy. Can I lower my LoL Ping? To lower your ping in League of Legends, use a wired connection instead of WiFi, close unnecessary background applications, restart your router to resolve connectivity issues, choose the server closest to your location, update your network drivers to the latest version, disable VPNs and proxies, switch to a faster DNS server, and consider using a ping reduction tool How to Check Your Fortnite Ping Without Opening the Game. When playing online games, your ping (or latency) determines how quickly your actions in the game are registered by the server. Whether you need to test your ping before starting a League of Legends coaching session or ranked game, you'll easily be able to "dodge a bullet" if your ping is higher than usual. Test various locations and then use tools such as SpeedTest. When I'm in the menu I get 19ms ping on the UAE servers but as soon as I… This tool checks your ping to the data centers used by PUBG, which are hosted by Amazon Web Services (AWS) across different global regions. How to check Valorant Ping? What is League Ping Test & how does it work? Are you a LOL enthusiast wanting to know the ping time for connecting to the LOL server nearest to you? Well, congratulations to you as you have just discovered the best resource for doing this. You can use in-game settings, third-party applications, or dedicated websites to test your ping, allowing you to monitor and optimize your network performance for better gameplay. Virginia us-east-1: Canada Calgary ca-west-1: Canada Central ca-central-1: Mexico Central mx-central-1: Europe Paris eu-west-3: Europe London eu-west-2: Europe Ireland eu-west-1: Europe Spain eu-south-2: Europe Milan eu-south-1: Europe Stockholm eu-north-1: Europe Zurich eu-central-2: Europe Frankfurt eu Oct 10, 2019 · LoL (League of Legends) Ping Test. The idea behind League of Legends is that the player is a Summoner who controls their chosen Champion. For example, if you want to check your ping to different LoL servers, you would use these commands: BR (Brazil) server: ping 104. Yesterday i noticed my ping is 100+ on Middle East servers on all games however other servers remains the same ping. NET Desktop 8 to run. The app will automatically check your ping and display the result. A high ping can result in noticeable delays in actions like shooting or moving, which can detrimentally impact your gameplay. Measure the latency of your internet connection to the Apex Legends game servers in real-time with our Apex Legends Ping Test page. Feel free to use our ping test. If you don’t make a selection, the tool will automatically choose the closest server to you. For ping test are used ms units (1000 milliseconds = 1 second). While excitement over improved ping and localized features is palpable, concerns around ping consistency and rewards distribution linger among players. Test without waiting and for free. Aim for a ping under 20 ms for the smoothest play. PUBG Ping Checker is a tiny PUBG ping app that lets you find the ping within your machine and PUBG servers. Our Gaming Servers infrastructure is designed for low ping and high frame/tick rate and Its not designed for cloud storage or downloading purposes, in return we applied limited download speed rate policy to all our game servers in order to maintain latency/ping to the lowest as possible since high download rate effects latency immediatly which Sep 5, 2023 · I used to enjoy a solid ping of around 80-90ms when playing on the Middle East server in Warzone. The results of this test represent the median round trip time (RTT) latency to Azure storage endpoint, with lower RTT indicating superior performance. The response is given in milliseconds (ms), 1 second has 1000 ms. Select all. LoL Ping Checker is a tiny LoL ping app that lets you find the ping within your machine and LoL servers. You also have the option to select a server location of your choice. Select the regions you want to test; Middle East. First, you must click on the Start. Jun 6, 2023 · Type ping [server IP address] and press Enter to ping the desired server. The easiest way of checking Fortnite ping test and server status from different regions. Speed tests can measure upload speed, download speed, ping, latency, jitter, and more. Check closest data centers based on ping results. A ping test measures the round-trip time for data to travel from your device to a destination server and back. 152. I don’t think it’s a problem with internet because the internet speed is high. . The WonderNetwork Global Ping Statistics data is generated with the Where's It Up API, executing 30 pings from source (lefthand column) to destination (table header), displaying the average. Lower ping times indicate faster communication, essential for gaming, video calls, and other real-time applications. Each checkpoint location makes three requests, tracks the response times, and checks for errors. High ping, often known as “lag,” can cause delays, making your gameplay feel sluggish and unresponsive. 3 -t; EUW (Europe West) server: ping 104. It allowed me to have a competitive and enjoyable gaming experience, particularly when connecting with my friends from different regions. HTTP Ping. Just select a game or server, and your ping will be displayed in Click the "HTTP Ping" button to measure latency from your browser to various cloud provider datacenters. We would like to show you a description here but the site won’t allow us. com SOUTHERN AFRICA: pingtest-saf. Do you want to research connection speed for Saudi Arabia (SA)? TestMy. ds. How to Use Our Ping Test. net with ping test on the probes Global Ping Statistics → Riyadh Show ping to all cities, including distance and percentage of speed of light in a fiber optic cable (200,000km/s) Check your site’s localization Ping Test CS2 Ping Test Warhammer 40K Space Marine 2 Call of Duty: Black Ops 6 GTA 5 Valorant Ping Test LoL (League of Legends) Ping Test CS:GO Ping Test Path of Exile (POE) Apex Ping Test Fortnite Battle Royale Call of Duty: Modern Warfare Hearthstone Ping Test PUBG (PlayerUnknown's Battlegrounds) Rainbow Six Siege (RB6) Escape from Tarkov Middle East: ping-me. com; Middle East: ping-me. Compare the best Speed Test websites in the Middle East, read reviews, and learn about pricing and free demos. What is ping: ping is method to measure minimum time needed to send smallest possible amount of data and receive response. The easiest way to check your Fortnite ping is by using our real-time Fortnite ping tester tool. Enter a hostname or IP to check the latency from over 99 locations the world. 142. Global Ping Statistics → Tel Aviv Show ping to all cities, including distance and percentage of speed of light in a fiber optic cable (200,000km/s) Check your site’s localization Ping Test CS2 Ping Test Warhammer 40K Space Marine 2 Call of Duty: Black Ops 6 GTA 5 Valorant Ping Test LoL (League of Legends) Ping Test CS:GO Ping Test Path of Exile (POE) Apex Ping Test Fortnite Battle Royale Call of Duty: Modern Warfare Hearthstone Ping Test PUBG (PlayerUnknown's Battlegrounds) Rainbow Six Siege (RB6) Escape from Tarkov AWS latency test. Not I tried using ExitLag to reduce my ping, on Valorant without exitlag I get 130-140 ms on EU servers and 150 ms on Bahrain, with exitlag my ping is 40-60 ms on BH server, on League of Legends I found no difference in ping still 120-130 ms. Test your network latency to the nearest cloud provider in Microsoft Azure, Amazon Web Services, Google Cloud Platform and other cloud providers directly from your browser Click “Begin Test” to test your ping (or latency). Why You Need a Game Ping Test. A lower ping means a more responsive and fluid gaming experience. he. LOL like most games requires a decent ping. Tired of lagging at a key duel moment and losing the battle? WeCoach ping checker is here to help get your ping before even entering a game! Also, use our ping test tool to find the best server for your region, ensuring a high-speed, low-latency connection for every Fortnite session. Please wait. What is a Good Ping Test? A good ping test shows low latency, ideally below 20ms. I think it’s from home Etisalat wifi. com; Windows 10. UAE (me Global Latency Test. Player Unknown's Battlegrounds (PUBG) is a buy to play online multiplayer battle royale game where up to one hundred players can join into a single game to have a “battle royale” experience. com; If you use Windows 10, you are able to use this method for doing Fortnite a ping test. US East Ohio us-east-2: US East N. Global Ping Statistics → Dubai Show ping to all cities, including distance and percentage of speed of light in a fiber optic cable (200,000km/s) Check your site’s localization Within those few clicks, you can see your ping live. TestMy. However, my recent gaming sessions have taken a frustrating t Middle East: ping-me. Cells showing the average deviation of those pings are highlighted in green if they are within 10% of the lowest average ping , yellow if they are within Hosting - Affordable - High Performance - Low Ping - 24/7/365 Support - DDoS Protection - Free Trials - 11 Years Experience Latency, often referred to as ping, is the duration for data to travel from the source to the destination and back. Apex Legends Ping Test. Note: The application requires . Local Zone Latency median (ms) Regions Latency median (ms) Latency median (ms) Map Results are provided for illustration only, do not Nov 18, 2024 · The launch of the League of Legends Middle East server has elicited a mix of emotions from the community. Tested the servers via bgp. Since its launch in 2009, this World of Warcraft-inspired MMO game now has a massive playerbase. LOL Ping Checker is a simple tool that helps to check in-game ping before starting the game. Usual values for optics of cable connection is 5-20ms. on. AWS Speed Test . A ping test measures the round-trip time for data packets between your device and a server, indicating connection speed and reliability. Results are close to ICMP ping (via cmd or console). This site checks Fortnite's server status from your current location. com]. Regularly using this tool can help you ensure a consistently smooth gaming experience by allowing you to monitor your ping and address any connectivity issues before they impact your play. net to see what provides the highest speed. 141. Run free latency tests and network commands like ping, traceroute, HTTP and DNS resolve on probes located worldwide. The lowest measured value is displayed. Server statuses are live and confirmed each time this page is loaded, we do not cache data to avoid out of date information. If you want to check your Fortnite ping without launching the game, there are two main methods that can help: 1. After that, you need to type cmd and then hit Enter. How Do I Test My Ping? You can easily test your ping directly on GameServerPing. This will mean that test will also be influenced by other factors such as quality of interconnection of Middle East Internet Company Limited with Internet backbone. Jun 26, 2024 · ME Transfers Are Initially One-Way. Ideally, a good ping should range between 25 to 50 milliseconds (ms). PUBG Ping Checker. Ping your hosts, such as servers, websites, and APIs Uptrends' ping tool sends out requests from more than 40 of our global 233 checkpoints , or you can check by region: Europe, North America, South America, Australia, Asia, or the Middle East. It is a key indicator of network latency and is measured in milliseconds (ms). Ping, in this context, refers to the time it takes for a data packet to travel from your computer to the game server and back, typically measured in milliseconds (ms). 3 -t Find the top Speed Test websites in the Middle East in 2025 for your company. net's speed test database stores information on millions of Internet connections MIDDLE EAST: pingtest-mde. It has a 3 day trial and $5/month sub. Ping display between 20-60 ms are average ping and provide a decent experience. com Perform a 100-ping test to that address and log the results (replace <server address> with the address you determined in the above section). If you're experiencing lag, using a LoL ping test can help determine whether the issue is related to your internet connection or the game servers. Region Latency; Amazon Web Services™ us-east-1 Run free latency tests and network commands like ping, traceroute, HTTP and DNS resolve on probes located worldwide. Simply run our ping test to check the latency of your connection. What are Speed Test Websites in the Middle East? Speed test websites and speed test apps are tools that enable individuals or IT professionals to test the speed of an internet connection on any device. net's speed test database stores information on millions of Internet Middle East: ping-me. This online tool shows you the game ping sent via http from your region (NA, EUW, EUNE, OCE, LAN). May 12, 2024 · Middle east servers used to give 30-40 ms now past 1 month its bumped upto 150 ms dont know why. Using an Online Fortnite Ping Tester Tool. In this step, you need to enter this: ping -n 50; For example: ping ping-nae. What is a good ping for PUBG? The download, upload and ping test will be performed to the closest server available near your location. AWS Speed Test. If your ping exceeds 100ms, it may lead to lag that can affect your performance and responsiveness in the game. Test latency to AWS data centers from your location. jzncsawkfgymngakaaihpdwdiwgpdqppggkhztejebszktwchyeuredubymvabeemmxdiuoszodrfxphabpyxgqhk
Middle east ping test This online tool estimates the network latency from your browser to AWS EC2, Azure Storage Account, Alibaba OSS and Huawei Cloud OBS in Africa and Middle East. Test ping time for different AWS (Amazon Web Services) regions from your web browser Middle East: ping-me. Analysis takes ~10 seconds and will outbook your max, min and average ping over those 10 seconds, along with your ping live stream. epicgames. Globalping - Internet and web infrastructure monitoring and benchmarking by jsDelivr Toggle navigation Run a free ping network test from multiple locations including Dubai to any IP, hostname, domain or website you wish. The massively popular massively multiplayer online game. Anything under 100ms is acceptable for most online activities, while anything over 150ms may result in noticeable lag. Once you load the page, the tool Oct 3, 2023 · Asia: ping-asia. Lower ping means faster response, crucial for gaming and real-time activities. In order to give the new community time to stabilize, we're only accepting players into the ME server at first. Middle East: ping-me. My ping in EUW is 80ms i'm form North Africa , any idea what's the ping is gonna be in the new middle east server? About Press Copyright Contact us Creators Advertise Developers Terms Privacy Policy & Safety How YouTube works Test new features NFL Sunday Ticket Press Copyright So Ubisoft rolled UAE servers for the middle east players which is great. Oct 30, 2024 · Download the app from the repository GitHub: brawlhalla-ping-checker [github. 3 -t; EUNE (Europe Nordic & East) server: ping 104. Test My Download Speed Test My Upload Speed. on Our League of Legends Ping Test Tool quickly measures your connection speed to provide accurate ping results for the game. Ping is tested via websockets technology. net's Download Speed Test and Upload Speed Test log connection information to allow users to research real world Internet speed test results. Transfers out of ME are scheduled to become available around September 3, 2024 at 11am PT / 9pm EEST, but note that this date/time may change depending on the state of the servers. Open the app and select your region’s server by clicking the corresponding button. am in the Middle East when I launched the game tell that I'm on a Middle East server it took 10-5 min to find a game then it join me on a European server with 100 pings but in the testing range it join me to a middle east server, So the middle east server work but for some reason, it forces me to European server LoL Ping Checker. brawlhalla. So we have put together this LOL ping test to make sure people can track the latency of their network connection. Measure the response (ping) to servers located around the world. 160. Do you want to research connection speed for The United Arab Emirates (AE)? TestMy. Can I lower my LoL Ping? To lower your ping in League of Legends, use a wired connection instead of WiFi, close unnecessary background applications, restart your router to resolve connectivity issues, choose the server closest to your location, update your network drivers to the latest version, disable VPNs and proxies, switch to a faster DNS server, and consider using a ping reduction tool How to Check Your Fortnite Ping Without Opening the Game. When playing online games, your ping (or latency) determines how quickly your actions in the game are registered by the server. Whether you need to test your ping before starting a League of Legends coaching session or ranked game, you'll easily be able to "dodge a bullet" if your ping is higher than usual. Test various locations and then use tools such as SpeedTest. When I'm in the menu I get 19ms ping on the UAE servers but as soon as I… This tool checks your ping to the data centers used by PUBG, which are hosted by Amazon Web Services (AWS) across different global regions. How to check Valorant Ping? What is League Ping Test & how does it work? Are you a LOL enthusiast wanting to know the ping time for connecting to the LOL server nearest to you? Well, congratulations to you as you have just discovered the best resource for doing this. You can use in-game settings, third-party applications, or dedicated websites to test your ping, allowing you to monitor and optimize your network performance for better gameplay. Virginia us-east-1: Canada Calgary ca-west-1: Canada Central ca-central-1: Mexico Central mx-central-1: Europe Paris eu-west-3: Europe London eu-west-2: Europe Ireland eu-west-1: Europe Spain eu-south-2: Europe Milan eu-south-1: Europe Stockholm eu-north-1: Europe Zurich eu-central-2: Europe Frankfurt eu Oct 10, 2019 · LoL (League of Legends) Ping Test. The idea behind League of Legends is that the player is a Summoner who controls their chosen Champion. For example, if you want to check your ping to different LoL servers, you would use these commands: BR (Brazil) server: ping 104. Yesterday i noticed my ping is 100+ on Middle East servers on all games however other servers remains the same ping. NET Desktop 8 to run. The app will automatically check your ping and display the result. A high ping can result in noticeable delays in actions like shooting or moving, which can detrimentally impact your gameplay. Measure the latency of your internet connection to the Apex Legends game servers in real-time with our Apex Legends Ping Test page. Feel free to use our ping test. If you don’t make a selection, the tool will automatically choose the closest server to you. For ping test are used ms units (1000 milliseconds = 1 second). While excitement over improved ping and localized features is palpable, concerns around ping consistency and rewards distribution linger among players. Test without waiting and for free. Aim for a ping under 20 ms for the smoothest play. PUBG Ping Checker is a tiny PUBG ping app that lets you find the ping within your machine and PUBG servers. Our Gaming Servers infrastructure is designed for low ping and high frame/tick rate and Its not designed for cloud storage or downloading purposes, in return we applied limited download speed rate policy to all our game servers in order to maintain latency/ping to the lowest as possible since high download rate effects latency immediatly which Sep 5, 2023 · I used to enjoy a solid ping of around 80-90ms when playing on the Middle East server in Warzone. The results of this test represent the median round trip time (RTT) latency to Azure storage endpoint, with lower RTT indicating superior performance. The response is given in milliseconds (ms), 1 second has 1000 ms. Select all. LoL Ping Checker is a tiny LoL ping app that lets you find the ping within your machine and LoL servers. You also have the option to select a server location of your choice. Select the regions you want to test; Middle East. First, you must click on the Start. Jun 6, 2023 · Type ping [server IP address] and press Enter to ping the desired server. The easiest way of checking Fortnite ping test and server status from different regions. Speed tests can measure upload speed, download speed, ping, latency, jitter, and more. Check closest data centers based on ping results. A ping test measures the round-trip time for data to travel from your device to a destination server and back. 152. I don’t think it’s a problem with internet because the internet speed is high. . The WonderNetwork Global Ping Statistics data is generated with the Where's It Up API, executing 30 pings from source (lefthand column) to destination (table header), displaying the average. Lower ping times indicate faster communication, essential for gaming, video calls, and other real-time applications. Each checkpoint location makes three requests, tracks the response times, and checks for errors. High ping, often known as “lag,” can cause delays, making your gameplay feel sluggish and unresponsive. 3 -t; EUW (Europe West) server: ping 104. It allowed me to have a competitive and enjoyable gaming experience, particularly when connecting with my friends from different regions. HTTP Ping. Just select a game or server, and your ping will be displayed in Click the "HTTP Ping" button to measure latency from your browser to various cloud provider datacenters. We would like to show you a description here but the site won’t allow us. com SOUTHERN AFRICA: pingtest-saf. Do you want to research connection speed for Saudi Arabia (SA)? TestMy. ds. How to Use Our Ping Test. net with ping test on the probes Global Ping Statistics → Riyadh Show ping to all cities, including distance and percentage of speed of light in a fiber optic cable (200,000km/s) Check your site’s localization Ping Test CS2 Ping Test Warhammer 40K Space Marine 2 Call of Duty: Black Ops 6 GTA 5 Valorant Ping Test LoL (League of Legends) Ping Test CS:GO Ping Test Path of Exile (POE) Apex Ping Test Fortnite Battle Royale Call of Duty: Modern Warfare Hearthstone Ping Test PUBG (PlayerUnknown's Battlegrounds) Rainbow Six Siege (RB6) Escape from Tarkov Middle East: ping-me. com; Middle East: ping-me. Compare the best Speed Test websites in the Middle East, read reviews, and learn about pricing and free demos. What is ping: ping is method to measure minimum time needed to send smallest possible amount of data and receive response. The easiest way to check your Fortnite ping is by using our real-time Fortnite ping tester tool. Enter a hostname or IP to check the latency from over 99 locations the world. 142. Global Ping Statistics → Tel Aviv Show ping to all cities, including distance and percentage of speed of light in a fiber optic cable (200,000km/s) Check your site’s localization Ping Test CS2 Ping Test Warhammer 40K Space Marine 2 Call of Duty: Black Ops 6 GTA 5 Valorant Ping Test LoL (League of Legends) Ping Test CS:GO Ping Test Path of Exile (POE) Apex Ping Test Fortnite Battle Royale Call of Duty: Modern Warfare Hearthstone Ping Test PUBG (PlayerUnknown's Battlegrounds) Rainbow Six Siege (RB6) Escape from Tarkov AWS latency test. Not I tried using ExitLag to reduce my ping, on Valorant without exitlag I get 130-140 ms on EU servers and 150 ms on Bahrain, with exitlag my ping is 40-60 ms on BH server, on League of Legends I found no difference in ping still 120-130 ms. Test your network latency to the nearest cloud provider in Microsoft Azure, Amazon Web Services, Google Cloud Platform and other cloud providers directly from your browser Click “Begin Test” to test your ping (or latency). Why You Need a Game Ping Test. A lower ping means a more responsive and fluid gaming experience. he. LOL like most games requires a decent ping. Tired of lagging at a key duel moment and losing the battle? WeCoach ping checker is here to help get your ping before even entering a game! Also, use our ping test tool to find the best server for your region, ensuring a high-speed, low-latency connection for every Fortnite session. Please wait. What is a Good Ping Test? A good ping test shows low latency, ideally below 20ms. I think it’s from home Etisalat wifi. com; Windows 10. UAE (me Global Latency Test. Player Unknown's Battlegrounds (PUBG) is a buy to play online multiplayer battle royale game where up to one hundred players can join into a single game to have a “battle royale” experience. com; If you use Windows 10, you are able to use this method for doing Fortnite a ping test. US East Ohio us-east-2: US East N. Global Ping Statistics → Dubai Show ping to all cities, including distance and percentage of speed of light in a fiber optic cable (200,000km/s) Check your site’s localization Within those few clicks, you can see your ping live. TestMy. However, my recent gaming sessions have taken a frustrating t Middle East: ping-me. Cells showing the average deviation of those pings are highlighted in green if they are within 10% of the lowest average ping , yellow if they are within Hosting - Affordable - High Performance - Low Ping - 24/7/365 Support - DDoS Protection - Free Trials - 11 Years Experience Latency, often referred to as ping, is the duration for data to travel from the source to the destination and back. Apex Legends Ping Test. Note: The application requires . Local Zone Latency median (ms) Regions Latency median (ms) Latency median (ms) Map Results are provided for illustration only, do not Nov 18, 2024 · The launch of the League of Legends Middle East server has elicited a mix of emotions from the community. Tested the servers via bgp. Since its launch in 2009, this World of Warcraft-inspired MMO game now has a massive playerbase. LOL Ping Checker is a simple tool that helps to check in-game ping before starting the game. Usual values for optics of cable connection is 5-20ms. on. AWS Speed Test . A ping test measures the round-trip time for data packets between your device and a server, indicating connection speed and reliability. Results are close to ICMP ping (via cmd or console). This site checks Fortnite's server status from your current location. com]. Regularly using this tool can help you ensure a consistently smooth gaming experience by allowing you to monitor your ping and address any connectivity issues before they impact your play. net to see what provides the highest speed. 141. Run free latency tests and network commands like ping, traceroute, HTTP and DNS resolve on probes located worldwide. The lowest measured value is displayed. Server statuses are live and confirmed each time this page is loaded, we do not cache data to avoid out of date information. If you want to check your Fortnite ping without launching the game, there are two main methods that can help: 1. After that, you need to type cmd and then hit Enter. How Do I Test My Ping? You can easily test your ping directly on GameServerPing. This will mean that test will also be influenced by other factors such as quality of interconnection of Middle East Internet Company Limited with Internet backbone. Jun 26, 2024 · ME Transfers Are Initially One-Way. Ideally, a good ping should range between 25 to 50 milliseconds (ms). PUBG Ping Checker. Ping your hosts, such as servers, websites, and APIs Uptrends' ping tool sends out requests from more than 40 of our global 233 checkpoints , or you can check by region: Europe, North America, South America, Australia, Asia, or the Middle East. It is a key indicator of network latency and is measured in milliseconds (ms). Ping, in this context, refers to the time it takes for a data packet to travel from your computer to the game server and back, typically measured in milliseconds (ms). 3 -t Find the top Speed Test websites in the Middle East in 2025 for your company. net's speed test database stores information on millions of Internet connections MIDDLE EAST: pingtest-mde. It has a 3 day trial and $5/month sub. Ping display between 20-60 ms are average ping and provide a decent experience. com Perform a 100-ping test to that address and log the results (replace <server address> with the address you determined in the above section). If you're experiencing lag, using a LoL ping test can help determine whether the issue is related to your internet connection or the game servers. Region Latency; Amazon Web Services™ us-east-1 Run free latency tests and network commands like ping, traceroute, HTTP and DNS resolve on probes located worldwide. Simply run our ping test to check the latency of your connection. What are Speed Test Websites in the Middle East? Speed test websites and speed test apps are tools that enable individuals or IT professionals to test the speed of an internet connection on any device. net's speed test database stores information on millions of Internet Middle East: ping-me. This online tool shows you the game ping sent via http from your region (NA, EUW, EUNE, OCE, LAN). May 12, 2024 · Middle east servers used to give 30-40 ms now past 1 month its bumped upto 150 ms dont know why. Using an Online Fortnite Ping Tester Tool. In this step, you need to enter this: ping -n 50; For example: ping ping-nae. What is a good ping for PUBG? The download, upload and ping test will be performed to the closest server available near your location. AWS Speed Test. If your ping exceeds 100ms, it may lead to lag that can affect your performance and responsiveness in the game. Test latency to AWS data centers from your location. jzncsa wkfgym ngakaa ihpdwdi wgpdq ppg gkhzte jebszk twc hyeuredub ymvab eemmxdi uoszo drfxphab pyxgqhk